PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.G02493.1.p
Common NameEUGRSUZ_G02493, LOC104453941
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family Dof
Protein Properties Length: 241aa    MW: 26499.5 Da    PI: 8.2665
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.G02493.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof119.81e-37141200261
            zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                       +ek+l+cprC+s++tkfCyynny+l+qPr++C++C+ryWt+GG++rn+PvG+grrk+k+s
  Eucgr.G02493.1.p 141 PEKILPCPRCNSMDTKFCYYNNYNLNQPRHLCRKCQRYWTAGGTMRNIPVGAGRRKSKNS 200
                       78999****************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-29138198IPR003851Zinc finger, Dof-type
PfamPF027015.1E-32143199IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.062145199IPR003851Zinc finger, Dof-type
PROSITE patternPS013610147183IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 241 aa     Download sequence    Send to blast
MLEMKDAAIK LFGQTIGLRE KRGVLDEPSW GGGKEFASEA GGPGSWDRGG SVSADAAWQE  60
QRGGREAGET RGDKALSERE PMNEKYEEGI SCWAVDNPKD SAESTIINQK DETGRETSPP  120
SAQNKEESET SISRETTLKK PEKILPCPRC NSMDTKFCYY NNYNLNQPRH LCRKCQRYWT  180
AGGTMRNIPV GAGRRKSKNS YAATVALFHN TGVPESLRAD CAGDLKTAGT TILRFGFRFS  240
*
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.G02493.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010066902.11e-180PREDICTED: cyclic dof factor 2-like
TrEMBLA0A059BFI31e-180A0A059BFI3_EUCGR; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM28092669
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G39660.24e-41cycling DOF factor 2